PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN15701.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family bHLH
Protein Properties Length: 247aa    MW: 28087.7 Da    PI: 7.3957
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN15701.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH376.2e-1274126155
                 CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
         HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                 +++ h e+E++RR+++ +  + Lr+llP ++   ++K s ++   +Av+YI++Lq
  KHN15701.1  74 KKMVHREIEKQRRQEMATLHASLRSLLPLDF--IKGKRSISDQMNEAVNYINHLQ 126
                 6889*************************75..*********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474594.58E-1273144IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088812.76773125IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000834.20E-874130No hitNo description
PfamPF000105.4E-974126IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.101.8E-1074146IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003530.009879131IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MFPLQRGNEL VIQFSNGHHP QHKISQDLIL DDQDIDQSPL VGYSDKKLRT SRPKKLFYHE  60
ADTCHANSNQ EYTKKMVHRE IEKQRRQEMA TLHASLRSLL PLDFIKGKRS ISDQMNEAVN  120
YINHLQKNIK ELSDKRDKLK KKPSIINSSP EDHENYKHAS SGFTVHQNSG GAVGIEISGF  180
SEEEVPLSKL LELVFEEGLE VVNCLSTKVN GRLLHSLQCE VDNSGSVDLS ELRRKFSDVI  240
PSLRCSA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0966000.0BT096600.1 Soybean clone JCVI-FLGm-20L20 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006605326.10.0PREDICTED: uncharacterized protein LOC100775836 isoform X1
TrEMBLA0A0B2Q2A70.0A0A0B2Q2A7_GLYSO; Transcription factor bHLH126
TrEMBLI1NGM60.0I1NGM6_SOYBN; Uncharacterized protein
STRINGGLYMA20G29120.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF79233125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51780.13e-34bHLH family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]